PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G04700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family B3
Protein Properties Length: 516aa    MW: 56829.1 Da    PI: 6.2477
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G04700.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.61.7e-162423063399
                      -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3  33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                      ++ ++++d+ g +W +++i +  ++r++lt+GW+ Fv+a +L +gD+ vF+  +r ++el+v+v+rk
  LPERR07G04700.1 242 GQNIVVTDLLGARWGFRHIRNAADDRHMLTDGWSAFVNARRLYDGDTEVFM--RRPSGELLVGVRRK 306
                      4579***************9*******************************..679*********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100177.96E-11229305No hitNo description
Gene3DG3DSA:2.40.330.101.2E-15233307IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.02E-14237310IPR015300DNA-binding pseudobarrel domain
PfamPF023624.1E-12242306IPR003340B3 DNA binding domain
PROSITE profilePS5086311.519245307IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MVQPPDDAAP AVDGDVSHAH AHAHACTVPY SGRIPDIVSR ADDQRRWRML QVDWNQTSPP  60
FSTIERRQVQ RRISDQTAFR PNQQVQAPML LQEDTQDPAD MHVQTTEQPP ANAATPVVID  120
QEIWFGCTAP YSGRLPNTGF VVYYFPDGHA EQCQASAYML PESERIVCTV GDVVLNINAE  180
THEPYAIFTL LPGVHPLQTR PLPAGPVPAA GERDCRTATP ASSSPTPAPS ASFPRLDDLD  240
TGQNIVVTDL LGARWGFRHI RNAADDRHML TDGWSAFVNA RRLYDGDTEV FMRRPSGELL  300
VGVRRKRFGG MPIGIQADRV AADAAKAASY GWELTAGHGG CSEVDASLRR APPLTPGTKV  360
RLMMNPEDTW RGSEPVLGNV LALDPQRAWR MIESSDEAAT TSATGAATAT TYAPSLGLQL  420
QTAASKSQQL PDGMKRKFYE IEMQYIVGKQ AGVEDYLDLI VIFNQMSALQ VETKELIENN  480
APLREIEENT NTMRNLVRKM RSLRAAVKRS MAGKHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A5e-2612130521224Auxin response factor 1
4ldw_A5e-2612130521224Auxin response factor 1
4ldw_B5e-2612130521224Auxin response factor 1
4ldy_A5e-2612130521224Auxin response factor 1
4ldy_B5e-2612130521224Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9WW930.0A0A0D9WW93_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP169621012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.42e-24auxin response factor 1